Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated, Yeast

Artikelnummer: BIM-RPC24898
Artikelname: Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated, Yeast
Artikelnummer: BIM-RPC24898
Hersteller Artikelnummer: RPC24898
Alternativnummer: BIM-RPC24898-20UG,BIM-RPC24898-100UG,BIM-RPC24898-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Rat
Konjugation: Unconjugated
Alternative Synonym: Anionic trypsin IPretrypsinogen ISerine protease 1
Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Prss1. Target Synonyms: Anionic trypsin IPretrypsinogen ISerine protease 1. Accession Number: P00762. Expression Region: 24-246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Target-Kategorie: Prss1