Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated, Yeast

Catalog Number: BIM-RPC24898
Article Name: Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24898
Supplier Catalog Number: RPC24898
Alternative Catalog Number: BIM-RPC24898-20UG,BIM-RPC24898-100UG,BIM-RPC24898-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Anionic trypsin IPretrypsinogen ISerine protease 1
Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Prss1. Target Synonyms: Anionic trypsin IPretrypsinogen ISerine protease 1. Accession Number: P00762. Expression Region: 24-246aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 25.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
Target: Prss1