Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24908
Artikelname: Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24908
Hersteller Artikelnummer: RPC24908
Alternativnummer: BIM-RPC24908-20UG,BIM-RPC24908-100UG,BIM-RPC24908-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Protein-tyrosine phosphatase receptor type Z polypeptide 1, Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2
Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTPRZ1. Target Synonyms: Protein-tyrosine phosphatase receptor type Z polypeptide 1, Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2. Accession Number: P23471. Expression Region: 36~300aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 32.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQY
Target-Kategorie: PTPRZ1