Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC24908
Article Name: Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24908
Supplier Catalog Number: RPC24908
Alternative Catalog Number: BIM-RPC24908-20UG,BIM-RPC24908-100UG,BIM-RPC24908-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Protein-tyrosine phosphatase receptor type Z polypeptide 1, Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2
Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTPRZ1. Target Synonyms: Protein-tyrosine phosphatase receptor type Z polypeptide 1, Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2. Accession Number: P23471. Expression Region: 36~300aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 32.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQY
Target: PTPRZ1