Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated, Yeast

Artikelnummer: BIM-RPC24933
Artikelname: Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated, Yeast
Artikelnummer: BIM-RPC24933
Hersteller Artikelnummer: RPC24933
Alternativnummer: BIM-RPC24933-20UG,BIM-RPC24933-100UG,BIM-RPC24933-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Feline
Konjugation: Unconjugated
Alternative Synonym: Amyloid fibril protein AACurated
Recombinant Cat Serum amyloid A protein (SAA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Felis catus (Cat) (Felis silvestris catus). Target Name: SAA1. Target Synonyms: Amyloid fibril protein AACurated. Accession Number: P19707. Expression Region: 1~90aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 12.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Target-Kategorie: SAA1