Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC24933
Article Name: Recombinant Cat Serum amyloid A protein (SAA1), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC24933
Supplier Catalog Number: RPC24933
Alternative Catalog Number: BIM-RPC24933-20UG,BIM-RPC24933-100UG,BIM-RPC24933-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Feline
Conjugation: Unconjugated
Alternative Names: Amyloid fibril protein AACurated
Recombinant Cat Serum amyloid A protein (SAA1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Felis catus (Cat) (Felis silvestris catus). Target Name: SAA1. Target Synonyms: Amyloid fibril protein AACurated. Accession Number: P19707. Expression Region: 1~90aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 12.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 12.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG
Target: SAA1