Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46), Unconjugated, Yeast

Artikelnummer: BIM-RPC25076
Artikelname: Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46), Unconjugated, Yeast
Artikelnummer: BIM-RPC25076
Hersteller Artikelnummer: RPC25076
Alternativnummer: BIM-RPC25076-20UG,BIM-RPC25076-100UG,BIM-RPC25076-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: p46
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110). Target Name: p46. Target Synonyms: p46. Accession Number: P0C0J8. Expression Region: 28~416aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: CGQTESGSTSDSKPQAETLKHKVSNDSIRIALTDPDNPRWISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANLSPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLITGSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSIDQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMKVLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQSFLTINKDPAGGNKIKAVGSK
Target-Kategorie: p46