Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46), Unconjugated, Yeast

Catalog Number: BIM-RPC25076
Article Name: Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25076
Supplier Catalog Number: RPC25076
Alternative Catalog Number: BIM-RPC25076-20UG,BIM-RPC25076-100UG,BIM-RPC25076-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: p46
Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110). Target Name: p46. Target Synonyms: p46. Accession Number: P0C0J8. Expression Region: 28~416aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: CGQTESGSTSDSKPQAETLKHKVSNDSIRIALTDPDNPRWISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANLSPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLITGSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSIDQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMKVLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQSFLTINKDPAGGNKIKAVGSK
Target: p46