Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated, Yeast

Artikelnummer: BIM-RPC25131
Artikelname: Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated, Yeast
Artikelnummer: BIM-RPC25131
Hersteller Artikelnummer: RPC25131
Alternativnummer: BIM-RPC25131-20UG,BIM-RPC25131-100UG,BIM-RPC25131-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Tick anticoagulant peptide, TAP
Recombinant Ornithodoros moubata Tick anticoagulant peptide is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ornithodoros moubata (Soft tick) (Argasid tick). Target Name: Ornithodoros moubata Tick anticoagulant peptide. Target Synonyms: Tick anticoagulant peptide, TAP. Accession Number: P17726. Expression Region: 1~60aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Target-Kategorie: Ornithodoros moubata Tick anticoagulant peptide