Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated, Yeast

Catalog Number: BIM-RPC25131
Article Name: Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25131
Supplier Catalog Number: RPC25131
Alternative Catalog Number: BIM-RPC25131-20UG,BIM-RPC25131-100UG,BIM-RPC25131-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Tick anticoagulant peptide, TAP
Recombinant Ornithodoros moubata Tick anticoagulant peptide is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ornithodoros moubata (Soft tick) (Argasid tick). Target Name: Ornithodoros moubata Tick anticoagulant peptide. Target Synonyms: Tick anticoagulant peptide, TAP. Accession Number: P17726. Expression Region: 1~60aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Target: Ornithodoros moubata Tick anticoagulant peptide