Recombinant E. coli Beta-lactamase CTX-M-1 (bla), Unconjugated, Yeast

Artikelnummer: BIM-RPC25154
Artikelname: Recombinant E. coli Beta-lactamase CTX-M-1 (bla), Unconjugated, Yeast
Artikelnummer: BIM-RPC25154
Hersteller Artikelnummer: RPC25154
Alternativnummer: BIM-RPC25154-20UG,BIM-RPC25154-100UG,BIM-RPC25154-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: Beta-lactamase MEN-1Cefotaximase 1men1
Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli. Target Name: bla. Target Synonyms: Beta-lactamase MEN-1Cefotaximase 1men1. Accession Number: P28585. Expression Region: 29~291aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 30.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 30.2kDa
Tag: C-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASA
Target-Kategorie: bla