Recombinant E. coli Beta-lactamase CTX-M-1 (bla), Unconjugated, Yeast

Catalog Number: BIM-RPC25154
Article Name: Recombinant E. coli Beta-lactamase CTX-M-1 (bla), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25154
Supplier Catalog Number: RPC25154
Alternative Catalog Number: BIM-RPC25154-20UG,BIM-RPC25154-100UG,BIM-RPC25154-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Beta-lactamase MEN-1Cefotaximase 1men1
Recombinant E. coli Beta-lactamase CTX-M-1 (bla) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: E. coli. Target Name: bla. Target Synonyms: Beta-lactamase MEN-1Cefotaximase 1men1. Accession Number: P28585. Expression Region: 29~291aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 30.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.2kDa
Tag: C-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASA
Target: bla