Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27505
Artikelname: Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27505
Hersteller Artikelnummer: RPC27505
Alternativnummer: BIM-RPC27505-20UG,BIM-RPC27505-100UG,BIM-RPC27505-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Cell growth-inhibiting gene 27 proteinFolate hydrolase 1Folylpoly-gamma-glutamate carboxypeptidase, FGCPGlutamate carboxypeptidase II, GCPIIMembrane glutamate carboxypeptidase, mGCPN-acetylated-alpha-linked acidic dipeptidase I, NAALADase IProstate-specific membrane antigen, PSM, PSMAPteroylpoly-gamma-glutamate carboxypeptidase
Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FOLH1. Target Synonyms: Cell growth-inhibiting gene 27 proteinFolate hydrolase 1Folylpoly-gamma-glutamate carboxypeptidase, FGCPGlutamate carboxypeptidase II, GCPIIMembrane glutamate carboxypeptidase, mGCPN-acetylated-alpha-linked acidic dipeptidase I. Accession Number: Q04609. Expression Region: 48~750aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 83.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 83.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDA
Target-Kategorie: FOLH1