Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27505
Article Name: Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27505
Supplier Catalog Number: RPC27505
Alternative Catalog Number: BIM-RPC27505-20UG,BIM-RPC27505-100UG,BIM-RPC27505-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cell growth-inhibiting gene 27 proteinFolate hydrolase 1Folylpoly-gamma-glutamate carboxypeptidase, FGCPGlutamate carboxypeptidase II, GCPIIMembrane glutamate carboxypeptidase, mGCPN-acetylated-alpha-linked acidic dipeptidase I, NAALADase IProstate-specific membrane antigen, PSM, PSMAPteroylpoly-gamma-glutamate carboxypeptidase
Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FOLH1. Target Synonyms: Cell growth-inhibiting gene 27 proteinFolate hydrolase 1Folylpoly-gamma-glutamate carboxypeptidase, FGCPGlutamate carboxypeptidase II, GCPIIMembrane glutamate carboxypeptidase, mGCPN-acetylated-alpha-linked acidic dipeptidase I. Accession Number: Q04609. Expression Region: 48~750aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 83.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 83.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDA
Target: FOLH1