Recombinant Human Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli

Artikelnummer: BIM-RPC27511
Artikelname: Recombinant Human Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli
Artikelnummer: BIM-RPC27511
Hersteller Artikelnummer: RPC27511
Alternativnummer: BIM-RPC27511-20UG,BIM-RPC27511-100UG,BIM-RPC27511-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Epididymis-specific glutathione peroxidase-like protein
Recombinant Human Epididymal secretory glutathione peroxidase (GPX5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GPX5. Target Synonyms: Epididymis-specific glutathione peroxidase-like protein. Accession Number: O75715. Expression Region: 1~100aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 42.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.9kDa
Tag: N-Terminal 6Xhis-Gst-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Target-Kategorie: GPX5