Recombinant Human Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli

Catalog Number: BIM-RPC27511
Article Name: Recombinant Human Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27511
Supplier Catalog Number: RPC27511
Alternative Catalog Number: BIM-RPC27511-20UG,BIM-RPC27511-100UG,BIM-RPC27511-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Epididymis-specific glutathione peroxidase-like protein
Recombinant Human Epididymal secretory glutathione peroxidase (GPX5) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: GPX5. Target Synonyms: Epididymis-specific glutathione peroxidase-like protein. Accession Number: O75715. Expression Region: 1~100aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 42.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.9kDa
Tag: N-Terminal 6Xhis-Gst-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Target: GPX5