Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27554
Artikelname: Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27554
Hersteller Artikelnummer: RPC27554
Alternativnummer: BIM-RPC27554-20UG,BIM-RPC27554-100UG,BIM-RPC27554-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Sodium channel protein brain I subunit alpha, Sodium channel protein type I subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.1
Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SCN1A. Target Synonyms: Sodium channel protein brain I subunit alpha, Sodium channel protein type I subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.1. Accession Number: P35498. Expression Region: 1~128aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 18.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
Target-Kategorie: SCN1A