Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27554
Article Name: Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27554
Supplier Catalog Number: RPC27554
Alternative Catalog Number: BIM-RPC27554-20UG,BIM-RPC27554-100UG,BIM-RPC27554-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Sodium channel protein brain I subunit alpha, Sodium channel protein type I subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.1
Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SCN1A. Target Synonyms: Sodium channel protein brain I subunit alpha, Sodium channel protein type I subunit alpha, Voltage-gated sodium channel subunit alpha Nav1.1. Accession Number: P35498. Expression Region: 1~128aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 18.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS
Target: SCN1A