Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27555
Artikelname: Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27555
Hersteller Artikelnummer: RPC27555
Alternativnummer: BIM-RPC27555-20UG,BIM-RPC27555-100UG,BIM-RPC27555-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: Splicing factor 3B subunit 3(Pre-mRNA-splicing factor SF3b 130 kDa subunit, SF3b130, Spliceosome-associated protein 130, SAP 130)
Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: SF3B3. Target Synonyms: Splicing factor 3B subunit 3(Pre-mRNA-splicing factor SF3b 130 kDa subunit, SF3b130, Spliceosome-associated protein 130, SAP 130). Accession Number: A0JN52. Expression Region: 860~1186aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGS
Target-Kategorie: SF3B3