Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27555
Article Name: Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27555
Supplier Catalog Number: RPC27555
Alternative Catalog Number: BIM-RPC27555-20UG,BIM-RPC27555-100UG,BIM-RPC27555-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Splicing factor 3B subunit 3(Pre-mRNA-splicing factor SF3b 130 kDa subunit, SF3b130, Spliceosome-associated protein 130, SAP 130)
Recombinant Bovine Splicing factor 3B subunit 3 (SF3B3), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: SF3B3. Target Synonyms: Splicing factor 3B subunit 3(Pre-mRNA-splicing factor SF3b 130 kDa subunit, SF3b130, Spliceosome-associated protein 130, SAP 130). Accession Number: A0JN52. Expression Region: 860~1186aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 42.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVLIGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQLIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRGLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGS
Target: SF3B3