Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27558
Artikelname: Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27558
Hersteller Artikelnummer: RPC27558
Alternativnummer: BIM-RPC27558-20UG,BIM-RPC27558-100UG,BIM-RPC27558-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Glucose transporter type 1, erythrocyte/brain (GLUT-1, HepG2 glucose transporter)
Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SLC2A1. Target Synonyms: Glucose transporter type 1, erythrocyte/brain (GLUT-1, HepG2 glucose transporter). Accession Number: P11166. Expression Region: 207~271aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 15.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP
Target-Kategorie: SLC2A1