Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27558
Article Name: Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27558
Supplier Catalog Number: RPC27558
Alternative Catalog Number: BIM-RPC27558-20UG,BIM-RPC27558-100UG,BIM-RPC27558-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Glucose transporter type 1, erythrocyte/brain (GLUT-1, HepG2 glucose transporter)
Recombinant Human Solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SLC2A1. Target Synonyms: Glucose transporter type 1, erythrocyte/brain (GLUT-1, HepG2 glucose transporter). Accession Number: P11166. Expression Region: 207~271aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 15.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 15.2kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: CPESPRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQP
Target: SLC2A1