Recombinant Staphylococcus aureus Staphopain A (sspP), Unconjugated, E. coli

Artikelnummer: BIM-RPC27579
Artikelname: Recombinant Staphylococcus aureus Staphopain A (sspP), Unconjugated, E. coli
Artikelnummer: BIM-RPC27579
Hersteller Artikelnummer: RPC27579
Alternativnummer: BIM-RPC27579-20UG,BIM-RPC27579-100UG,BIM-RPC27579-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Staphopain A(EC 3.4.22.48, Staphylococcal cysteine proteinase A, Staphylopain A)
Recombinant Staphylococcus aureus Staphopain A (sspP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: sspP. Target Synonyms: Staphopain A(EC 3.4.22.48, Staphylococcal cysteine proteinase A, Staphylopain A). Accession Number: P81297. Expression Region: 215~388aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
Target-Kategorie: sspP