Recombinant Staphylococcus aureus Staphopain A (sspP), Unconjugated, E. coli

Catalog Number: BIM-RPC27579
Article Name: Recombinant Staphylococcus aureus Staphopain A (sspP), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27579
Supplier Catalog Number: RPC27579
Alternative Catalog Number: BIM-RPC27579-20UG,BIM-RPC27579-100UG,BIM-RPC27579-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Staphopain A(EC 3.4.22.48, Staphylococcal cysteine proteinase A, Staphylopain A)
Recombinant Staphylococcus aureus Staphopain A (sspP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: sspP. Target Synonyms: Staphopain A(EC 3.4.22.48, Staphylococcal cysteine proteinase A, Staphylopain A). Accession Number: P81297. Expression Region: 215~388aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
Target: sspP