Recombinant Candida albicans Candidapepsin-2 (SAP2), Unconjugated, E. coli

Artikelnummer: BIM-RPC27592
Artikelname: Recombinant Candida albicans Candidapepsin-2 (SAP2), Unconjugated, E. coli
Artikelnummer: BIM-RPC27592
Hersteller Artikelnummer: RPC27592
Alternativnummer: BIM-RPC27592-20UG,BIM-RPC27592-100UG,BIM-RPC27592-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: ACP 2Aspartate protease 2Secreted aspartic protease 2
Recombinant Candida albicans Candidapepsin-2 (SAP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (Yeast). Target Name: SAP2. Target Synonyms: ACP 2Aspartate protease 2Secreted aspartic protease 2. Accession Number: P0CS83. Expression Region: 57~398aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 42.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 42.4kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVD
Target-Kategorie: SAP2