Recombinant Candida albicans Candidapepsin-2 (SAP2), Unconjugated, E. coli

Catalog Number: BIM-RPC27592
Article Name: Recombinant Candida albicans Candidapepsin-2 (SAP2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27592
Supplier Catalog Number: RPC27592
Alternative Catalog Number: BIM-RPC27592-20UG,BIM-RPC27592-100UG,BIM-RPC27592-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: ACP 2Aspartate protease 2Secreted aspartic protease 2
Recombinant Candida albicans Candidapepsin-2 (SAP2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (Yeast). Target Name: SAP2. Target Synonyms: ACP 2Aspartate protease 2Secreted aspartic protease 2. Accession Number: P0CS83. Expression Region: 57~398aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 42.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.4kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVD
Target: SAP2