Recombinant Bacillus subtilis Endoglucanase (eglS), Unconjugated, E. coli

Artikelnummer: BIM-RPC27596
Artikelname: Recombinant Bacillus subtilis Endoglucanase (eglS), Unconjugated, E. coli
Artikelnummer: BIM-RPC27596
Hersteller Artikelnummer: RPC27596
Alternativnummer: BIM-RPC27596-20UG,BIM-RPC27596-100UG,BIM-RPC27596-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Carboxymethyl-cellulase, CMCase, Cellulase, Endo-1,4-beta-glucanase
Recombinant Bacillus subtilis Endoglucanase (eglS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: eglS. Target Synonyms: Carboxymethyl-cellulase, CMCase, Cellulase, Endo-1,4-beta-glucanase. Accession Number: P10475. Expression Region: 30~499aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal V5-Tagged. Theoretical MW: 59.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 59.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal V5-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSK
Target-Kategorie: eglS