Recombinant Bacillus subtilis Endoglucanase (eglS), Unconjugated, E. coli

Catalog Number: BIM-RPC27596
Article Name: Recombinant Bacillus subtilis Endoglucanase (eglS), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27596
Supplier Catalog Number: RPC27596
Alternative Catalog Number: BIM-RPC27596-20UG,BIM-RPC27596-100UG,BIM-RPC27596-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Carboxymethyl-cellulase, CMCase, Cellulase, Endo-1,4-beta-glucanase
Recombinant Bacillus subtilis Endoglucanase (eglS) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: eglS. Target Synonyms: Carboxymethyl-cellulase, CMCase, Cellulase, Endo-1,4-beta-glucanase. Accession Number: P10475. Expression Region: 30~499aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal V5-Tagged. Theoretical MW: 59.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 59.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal V5-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AGTKTPVAKNGQLSIKGTQLVNRDGKAVQLKGISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAKELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDIKPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLRDKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSK
Target: eglS