Recombinant Toxoplasma gondii Dense granule protein 2 (GRA2), Unconjugated, E. coli

Artikelnummer: BIM-RPC27599
Artikelname: Recombinant Toxoplasma gondii Dense granule protein 2 (GRA2), Unconjugated, E. coli
Artikelnummer: BIM-RPC27599
Hersteller Artikelnummer: RPC27599
Alternativnummer: BIM-RPC27599-20UG,BIM-RPC27599-100UG,BIM-RPC27599-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Parasite
Konjugation: Unconjugated
Alternative Synonym: 28 kDa antigenGP28.5
Recombinant Toxoplasma gondii Dense granule protein 2 (GRA2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Toxoplasma gondii. Target Name: GRA2. Target Synonyms: 28 kDa antigenGP28.5. Accession Number: P13404. Expression Region: 24~185aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 25.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 25.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQQEPEEPVSQRASRVAEQLFRKFLKFAENVGHHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANVESDRSTTTTQAPDSPNGLAETEVPVEPQQRAAHVPVPDFSQ
Target-Kategorie: GRA2