Recombinant Toxoplasma gondii Dense granule protein 2 (GRA2), Unconjugated, E. coli

Catalog Number: BIM-RPC27599
Article Name: Recombinant Toxoplasma gondii Dense granule protein 2 (GRA2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27599
Supplier Catalog Number: RPC27599
Alternative Catalog Number: BIM-RPC27599-20UG,BIM-RPC27599-100UG,BIM-RPC27599-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Parasite
Conjugation: Unconjugated
Alternative Names: 28 kDa antigenGP28.5
Recombinant Toxoplasma gondii Dense granule protein 2 (GRA2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Toxoplasma gondii. Target Name: GRA2. Target Synonyms: 28 kDa antigenGP28.5. Accession Number: P13404. Expression Region: 24~185aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 25.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.0kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AEFSGVVNQGPVDVPFSGKPLDERAVGGKGEHTPPLPDERQQEPEEPVSQRASRVAEQLFRKFLKFAENVGHHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKEAAGRGMVTVGKKLANVESDRSTTTTQAPDSPNGLAETEVPVEPQQRAAHVPVPDFSQ
Target: GRA2