Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase (NSP12), Unconjugated, E. coli

Artikelnummer: BIM-RPC27640
Artikelname: Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase (NSP12), Unconjugated, E. coli
Artikelnummer: BIM-RPC27640
Hersteller Artikelnummer: RPC27640
Alternativnummer: BIM-RPC27640-20UG,BIM-RPC27640-100UG,BIM-RPC27640-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase (NSP12) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Severe acute respiratory syndrome coronavirus 2. Target Name: NSP12. Accession Number: YP_009725307.1. Expression Region: 1~932aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 108.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 108.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAES
Target-Kategorie: NSP12