Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase (NSP12), Unconjugated, E. coli

Catalog Number: BIM-RPC27640
Article Name: Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase (NSP12), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27640
Supplier Catalog Number: RPC27640
Alternative Catalog Number: BIM-RPC27640-20UG,BIM-RPC27640-100UG,BIM-RPC27640-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Recombinant Severe acute respiratory syndrome coronavirus 2 RNA-dependent RNA polymerase (NSP12) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Severe acute respiratory syndrome coronavirus 2. Target Name: NSP12. Accession Number: YP_009725307.1. Expression Region: 1~932aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 108.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 108.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAES
Target: NSP12