Recombinant chimeric Dpo4 [synthetic construct], Unconjugated, E. coli

Artikelnummer: BIM-RPC27650
Artikelname: Recombinant chimeric Dpo4 [synthetic construct], Unconjugated, E. coli
Artikelnummer: BIM-RPC27650
Hersteller Artikelnummer: RPC27650
Alternativnummer: BIM-RPC27650-20UG,BIM-RPC27650-100UG,BIM-RPC27650-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Other
Konjugation: Unconjugated
Recombinant chimeric Dpo4 [synthetic construct] is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: synthetic construct. Target Name: chimeric Dpo4 [synthetic construct]. Accession Number: ABA03150.1. Expression Region: 1~353aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 44.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MIVLFVDFDYFFAQVEEVLNPELKGKPVAVCVFSGRFKDSGAIATANYEARKLGIKSGMPIPKAKEIAPNAIYLPIRKDLYKQVSDRIMYGILSKYSSKIEIASIDEAYLDITDRVKDYYEAYQLGKKIKDEIYQKEKITVTIGIAPNKVFAKIIAEMNKPNGLGILKPEEVEGFIRSLPIEEVPGVGDSIYSKLKEMEIKYLYDVLKVDFEKLKKEIGKSKASYLYSLARDEYNEPIRTRVRKSIGRIVTMKRN
Target-Kategorie: chimeric Dpo4 [synthetic construct]