Recombinant chimeric Dpo4 [synthetic construct], Unconjugated, E. coli

Catalog Number: BIM-RPC27650
Article Name: Recombinant chimeric Dpo4 [synthetic construct], Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27650
Supplier Catalog Number: RPC27650
Alternative Catalog Number: BIM-RPC27650-20UG,BIM-RPC27650-100UG,BIM-RPC27650-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Other
Conjugation: Unconjugated
Recombinant chimeric Dpo4 [synthetic construct] is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: synthetic construct. Target Name: chimeric Dpo4 [synthetic construct]. Accession Number: ABA03150.1. Expression Region: 1~353aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MIVLFVDFDYFFAQVEEVLNPELKGKPVAVCVFSGRFKDSGAIATANYEARKLGIKSGMPIPKAKEIAPNAIYLPIRKDLYKQVSDRIMYGILSKYSSKIEIASIDEAYLDITDRVKDYYEAYQLGKKIKDEIYQKEKITVTIGIAPNKVFAKIIAEMNKPNGLGILKPEEVEGFIRSLPIEEVPGVGDSIYSKLKEMEIKYLYDVLKVDFEKLKKEIGKSKASYLYSLARDEYNEPIRTRVRKSIGRIVTMKRN
Target: chimeric Dpo4 [synthetic construct]