Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA), Unconjugated, E. coli

Artikelnummer: BIM-RPC27669
Artikelname: Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA), Unconjugated, E. coli
Artikelnummer: BIM-RPC27669
Hersteller Artikelnummer: RPC27669
Alternativnummer: BIM-RPC27669-20UG,BIM-RPC27669-100UG,BIM-RPC27669-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Adhesin
Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Target Name: hbhA. Target Synonyms: Adhesin. Accession Number: P9WIP8. Expression Region: 2~199aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: AENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK
Target-Kategorie: hbhA