Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA), Unconjugated, E. coli

Catalog Number: BIM-RPC27669
Article Name: Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27669
Supplier Catalog Number: RPC27669
Alternative Catalog Number: BIM-RPC27669-20UG,BIM-RPC27669-100UG,BIM-RPC27669-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Adhesin
Recombinant Mycobacterium tuberculosis Heparin-binding hemagglutinin (hbhA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Target Name: hbhA. Target Synonyms: Adhesin. Accession Number: P9WIP8. Expression Region: 2~199aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AENSNIDDIKAPLLAALGAADLALATVNELITNLRERAEETRTDTRSRVEESRARLTKLQEDLPEQLTELREKFTAEELRKAAEGYLEAATSRYNELVERGEAALERLRSQQSFEEVSARAEGYVDQAVELTQEALGTVASQTRAVGERAAKLVGIELPKKAAPAKKAAPAKKAAPAKKAAAKKAPAKKAAAKKVTQK
Target: hbhA