Recombinant Corynephage omega Diphtheria toxin, Unconjugated, E. coli

Artikelnummer: BIM-RPC27672
Artikelname: Recombinant Corynephage omega Diphtheria toxin, Unconjugated, E. coli
Artikelnummer: BIM-RPC27672
Hersteller Artikelnummer: RPC27672
Alternativnummer: BIM-RPC27672-20UG,BIM-RPC27672-100UG,BIM-RPC27672-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: NAD(+)--diphthamide ADP-ribosyltransferase
Recombinant Corynephage omega Diphtheria toxin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Corynephage omega. Target Name: Corynephage omega Diphtheria toxin. Target Synonyms: NAD(+)--diphthamide ADP-ribosyltransferase. Accession Number: P00587. Expression Region: 26~218aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR
Target-Kategorie: Corynephage omega Diphtheria toxin