Recombinant Corynephage omega Diphtheria toxin, Unconjugated, E. coli

Catalog Number: BIM-RPC27672
Article Name: Recombinant Corynephage omega Diphtheria toxin, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27672
Supplier Catalog Number: RPC27672
Alternative Catalog Number: BIM-RPC27672-20UG,BIM-RPC27672-100UG,BIM-RPC27672-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: NAD(+)--diphthamide ADP-ribosyltransferase
Recombinant Corynephage omega Diphtheria toxin is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Corynephage omega. Target Name: Corynephage omega Diphtheria toxin. Target Synonyms: NAD(+)--diphthamide ADP-ribosyltransferase. Accession Number: P00587. Expression Region: 26~218aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GADDVVDSSKSFVMENFSSYHGTKPGYVDSIQKGIQKPKSGTQGNYDDDWKGFYSTDNKYDAAGYSVDNENPLSGKAGGVVKVTYPGLTKVLALKVDNAETIKKELGLSLTEPLMEQVGTEEFIKRFGDGASRVVLSLPFAEGSSSVEYINNWEQAKALSVELEINFETRGKRGQDAMYEYMAQACAGNRVRR
Target: Corynephage omega Diphtheria toxin