Recombinant Varicella-zoster virus Envelope glycoprotein L (gL), Unconjugated, E. coli

Artikelnummer: BIM-RPC27678
Artikelname: Recombinant Varicella-zoster virus Envelope glycoprotein L (gL), Unconjugated, E. coli
Artikelnummer: BIM-RPC27678
Hersteller Artikelnummer: RPC27678
Alternativnummer: BIM-RPC27678-20UG,BIM-RPC27678-100UG,BIM-RPC27678-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Recombinant Varicella-zoster virus Envelope glycoprotein L (gL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3). Target Name: gL. Accession Number: P09308. Expression Region: 22~159aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 22.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLAQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ
Target-Kategorie: gL