Recombinant Varicella-zoster virus Envelope glycoprotein L (gL), Unconjugated, E. coli

Catalog Number: BIM-RPC27678
Article Name: Recombinant Varicella-zoster virus Envelope glycoprotein L (gL), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27678
Supplier Catalog Number: RPC27678
Alternative Catalog Number: BIM-RPC27678-20UG,BIM-RPC27678-100UG,BIM-RPC27678-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Recombinant Varicella-zoster virus Envelope glycoprotein L (gL) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3). Target Name: gL. Accession Number: P09308. Expression Region: 22~159aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: LHLQDDTPLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCPVPEVILWFKDKQMAYWTNPYVTLKGLAQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ
Target: gL