Recombinant Apis mellifera Venom dipeptidyl peptidase 4, Unconjugated, E. coli

Artikelnummer: BIM-RPC27697
Artikelname: Recombinant Apis mellifera Venom dipeptidyl peptidase 4, Unconjugated, E. coli
Artikelnummer: BIM-RPC27697
Hersteller Artikelnummer: RPC27697
Alternativnummer: BIM-RPC27697-20UG,BIM-RPC27697-100UG,BIM-RPC27697-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bee
Konjugation: Unconjugated
Alternative Synonym: Venom dipeptidyl peptidase 4(Allergen C, Venom dipeptidyl peptidase IV, EC 3.4.14.5, allergen Api m 5)
Recombinant Apis mellifera Venom dipeptidyl peptidase 4 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apis mellifera (Honeybee). Target Name: Apis mellifera Venom dipeptidyl peptidase 4. Target Synonyms: Venom dipeptidyl peptidase 4(Allergen C, Venom dipeptidyl peptidase IV, EC 3.4.14.5, allergen Api m 5). Accession Number: B2D0J4. Expression Region: 24~276aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 36.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: KSVPRVIDQDLERYEPLEEEDHRGARVPFNLEETYDQSFRANSFNGTWKTDREILYSDNYVGDIRLFDVTTGSGTVLLDSSVTADFDKASVMFSFDNSHVAIGHDYVNGFRYSIHQKCTVYNIKSRTFTDIANGDRIPLFKWSPTRNALIYVHKNDIYYQVFFEGGSDTRRITNTGVPDIVFNGIPDWVYEEEVLGSPVAFWISPDGRHLAFATFNDTNVRDIVISKYGSPGNSRDQYPNEIRIKYPKAGTTN
Target-Kategorie: Apis mellifera Venom dipeptidyl peptidase 4