Recombinant Apis mellifera Venom dipeptidyl peptidase 4, Unconjugated, E. coli

Catalog Number: BIM-RPC27697
Article Name: Recombinant Apis mellifera Venom dipeptidyl peptidase 4, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27697
Supplier Catalog Number: RPC27697
Alternative Catalog Number: BIM-RPC27697-20UG,BIM-RPC27697-100UG,BIM-RPC27697-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bee
Conjugation: Unconjugated
Alternative Names: Venom dipeptidyl peptidase 4(Allergen C, Venom dipeptidyl peptidase IV, EC 3.4.14.5, allergen Api m 5)
Recombinant Apis mellifera Venom dipeptidyl peptidase 4 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apis mellifera (Honeybee). Target Name: Apis mellifera Venom dipeptidyl peptidase 4. Target Synonyms: Venom dipeptidyl peptidase 4(Allergen C, Venom dipeptidyl peptidase IV, EC 3.4.14.5, allergen Api m 5). Accession Number: B2D0J4. Expression Region: 24~276aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 36.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KSVPRVIDQDLERYEPLEEEDHRGARVPFNLEETYDQSFRANSFNGTWKTDREILYSDNYVGDIRLFDVTTGSGTVLLDSSVTADFDKASVMFSFDNSHVAIGHDYVNGFRYSIHQKCTVYNIKSRTFTDIANGDRIPLFKWSPTRNALIYVHKNDIYYQVFFEGGSDTRRITNTGVPDIVFNGIPDWVYEEEVLGSPVAFWISPDGRHLAFATFNDTNVRDIVISKYGSPGNSRDQYPNEIRIKYPKAGTTN
Target: Apis mellifera Venom dipeptidyl peptidase 4