Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1), Unconjugated, E. coli

Artikelnummer: BIM-RPC27708
Artikelname: Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1), Unconjugated, E. coli
Artikelnummer: BIM-RPC27708
Hersteller Artikelnummer: RPC27708
Alternativnummer: BIM-RPC27708-20UG,BIM-RPC27708-100UG,BIM-RPC27708-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: AMPK gamma1 (AMPK subunit gamma-1, AMPKg, Prkaac)
Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Prkag1. Target Synonyms: AMPK gamma1 (AMPK subunit gamma-1, AMPKg, Prkaac). Accession Number: O54950. Expression Region: 1~330aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 41.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYN
Target-Kategorie: Prkag1