Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1), Unconjugated, E. coli

Catalog Number: BIM-RPC27708
Article Name: Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27708
Supplier Catalog Number: RPC27708
Alternative Catalog Number: BIM-RPC27708-20UG,BIM-RPC27708-100UG,BIM-RPC27708-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: AMPK gamma1 (AMPK subunit gamma-1, AMPKg, Prkaac)
Recombinant Mouse 5-AMP-activated protein kinase subunit gamma-1 (Prkag1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Prkag1. Target Synonyms: AMPK gamma1 (AMPK subunit gamma-1, AMPKg, Prkaac). Accession Number: O54950. Expression Region: 1~330aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 41.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYN
Target: Prkag1