Recombinant E. coli Fe/S biogenesis protein NfuA (nfuA), Biotinylated, Unconjugated

Artikelnummer: BIM-RPC27709
Artikelname: Recombinant E. coli Fe/S biogenesis protein NfuA (nfuA), Biotinylated, Unconjugated
Artikelnummer: BIM-RPC27709
Hersteller Artikelnummer: RPC27709
Alternativnummer: BIM-RPC27709-20UG,BIM-RPC27709-100UG,BIM-RPC27709-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Recombinant E. coli Fe/S biogenesis protein NfuA (nfuA), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: ENT-E. coli (strain K12 / DH10B). Target Name: nfuA. Accession Number: B1X760. Expression Region: 1~191aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 68.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 68.8kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY
Target-Kategorie: nfuA