Recombinant E. coli Fe/S biogenesis protein NfuA (nfuA), Biotinylated, Unconjugated

Catalog Number: BIM-RPC27709
Article Name: Recombinant E. coli Fe/S biogenesis protein NfuA (nfuA), Biotinylated, Unconjugated
Biozol Catalog Number: BIM-RPC27709
Supplier Catalog Number: RPC27709
Alternative Catalog Number: BIM-RPC27709-20UG,BIM-RPC27709-100UG,BIM-RPC27709-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Recombinant E. coli Fe/S biogenesis protein NfuA (nfuA), Biotinylated is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: ENT-E. coli (strain K12 / DH10B). Target Name: nfuA. Accession Number: B1X760. Expression Region: 1~191aa. Tag Info: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged. Theoretical MW: 68.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 68.8kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY
Target: nfuA