Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27712
Artikelname: Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27712
Hersteller Artikelnummer: RPC27712
Alternativnummer: BIM-RPC27712-20UG,BIM-RPC27712-100UG,BIM-RPC27712-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: HECT domain and RCC1-like domain-containing protein 1 (HECT-type E3 ubiquitin transferase HERC1, p532, p619)
Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HERC1. Target Synonyms: HECT domain and RCC1-like domain-containing protein 1 (HECT-type E3 ubiquitin transferase HERC1, p532, p619). Accession Number: Q15751. Expression Region: 3975~4360aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: GMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSS
Target-Kategorie: HERC1