Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27712
Article Name: Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27712
Supplier Catalog Number: RPC27712
Alternative Catalog Number: BIM-RPC27712-20UG,BIM-RPC27712-100UG,BIM-RPC27712-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: HECT domain and RCC1-like domain-containing protein 1 (HECT-type E3 ubiquitin transferase HERC1, p532, p619)
Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HERC1. Target Synonyms: HECT domain and RCC1-like domain-containing protein 1 (HECT-type E3 ubiquitin transferase HERC1, p532, p619). Accession Number: Q15751. Expression Region: 3975~4360aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 48.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSS
Target: HERC1