Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC27744
Artikelname: Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC27744
Hersteller Artikelnummer: RPC27744
Alternativnummer: BIM-RPC27744-20UG,BIM-RPC27744-100UG,BIM-RPC27744-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bovine
Konjugation: Unconjugated
Alternative Synonym: Caspase recruitment domain-containing protein 15
Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: NOD2. Target Synonyms: Caspase recruitment domain-containing protein 15. Accession Number: Q6E804. Expression Region: 1~191aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 36.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36.8kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MCAQDAFQTQRSQLVELLVSGSLEGFESILDRLLSREVLSWEDYEGLSLVGQPISHLARRLLDTIWNKGTWGCEQLTAAVREAQADSQPPELPSSWDPHSPHPARDLQSHRPAIVRRLYGHVEGVLDLTQQRGFISQYETDEIRRPIFTSSQRARRLLDLATVKANGLAAFLLQCIQELPVPLALPFEDAA
Target-Kategorie: NOD2