Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC27744
Article Name: Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC27744
Supplier Catalog Number: RPC27744
Alternative Catalog Number: BIM-RPC27744-20UG,BIM-RPC27744-100UG,BIM-RPC27744-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Caspase recruitment domain-containing protein 15
Recombinant Bovine Nucleotide-binding oligomerization domain-containing protein 2 (NOD2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: NOD2. Target Synonyms: Caspase recruitment domain-containing protein 15. Accession Number: Q6E804. Expression Region: 1~191aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 36.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.8kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MCAQDAFQTQRSQLVELLVSGSLEGFESILDRLLSREVLSWEDYEGLSLVGQPISHLARRLLDTIWNKGTWGCEQLTAAVREAQADSQPPELPSSWDPHSPHPARDLQSHRPAIVRRLYGHVEGVLDLTQQRGFISQYETDEIRRPIFTSSQRARRLLDLATVKANGLAAFLLQCIQELPVPLALPFEDAA
Target: NOD2